1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Leptin
  5. Leptin Protein, Human (His)

Leptin is a cytokine-like sugar secretory protein secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. Leptin can activate the JAK2-STAT3 and PI3K-AKT/mTOR pathways to regulate energy metabolism, prolong the QT interval via MAPK in the myocardium, and play a protective role in the gastric mucosa by inducing NO/CGRP release via the vagus nerve. Circulating CRP protein binds to leptin and blocks signal transduction, leading to obesity resistance. Leptin Protein, Human (His) is a recombinant human Leptin protein expressed by E. coli with N-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Leptin is a cytokine-like sugar secretory protein secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. Leptin can activate the JAK2-STAT3 and PI3K-AKT/mTOR pathways to regulate energy metabolism, prolong the QT interval via MAPK in the myocardium, and play a protective role in the gastric mucosa by inducing NO/CGRP release via the vagus nerve. Circulating CRP protein binds to leptin and blocks signal transduction, leading to obesity resistance. Leptin Protein, Human (His) is a recombinant human Leptin protein expressed by E. coli with N-6*His tag.

Background

Leptin is a hormone secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. It belongs to the cytokine-like protein family. Leptin has a conserved four-helix bundle conformation, with a tertiary structure stabilized by disulfide bonds. It lacks a classical signal peptide but is secreted via a non-classical pathway. The C-terminal domain of leptin mediates receptor binding, while the N-terminal region promotes oligomerization. Leptin binds to the long receptor OB-Rb in hypothalamic neurons and peripheral tissues, activating the JAK2-STAT3 and PI3K-AKT/mTOR pathways, inhibiting food intake and enhancing energy expenditure. In cardiomyocytes, leptin mediates MAPK activation through OB-Rb, reducing heart rate and prolonging the QT interval, an effect that is independent of β-adrenergic signaling[1][2][3][4].
In the gastric mucosa, leptin stimulates sensory neurons to release NO and CGRP via the vagus nerve, enhancing blood flow and protecting tissues from ischemia-reperfusion injury. Circulating C-reactive protein (CRP) binds to leptin, blocks receptor interaction and attenuates STAT3 phosphorylation, leading to leptin resistance in obesity[3][4]. Upstream regulators of leptin include leptin secreted by adipocytes and CRP synthesized by the liver; downstream targets include STAT3, PI3K, eNOS and mTOR, which play a role in regulating metabolism, neurogenesis and vascular function[1][4].
In metabolic diseases, leptin resistance is associated with hyperleptinemia and inhibition of CRP-mediated signaling, and leptin supplementation may inhibit congenital lipodystrophy and type 2 diabetes[4]. At the same time, Leptin's direct effect on cardiac repolarization (QT interval prolongation) and its interaction with CRP may be involved in obesity-related arrhythmias and atherosclerosis[2]. Leptin also enhances gastric mucosal blood flow and protects against ischemic damage through vagus-sensory nerve-mediated NO/CGRP release, and can be used in the study of peptic ulcer disease[3].

Biological Activity

Fully biologically active determined by the dose dependent proliferation of MCF7 cells. The ED50 for this effect is 14.64 ng/mL, corresponding to a specific activity is 6.83×104 units/mg.

  • Fully biologically active determined by the dose dependent proliferation of MCF7 cells. The ED50 for this effect is 14.64 ng/mL, corresponding to a specific activity is 6.83×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P41159 (V22-C167)

Gene ID
Molecular Construction
N-term
6*His
Leptin (V22-C167)
Accession # P41159
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuLeptin; Obesity protein; OB
AA Sequence

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Leptin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Leptin Protein, Human (His)
Cat. No.:
HY-P7232A
Quantity:
MCE Japan Authorized Agent: