1. Recombinant Proteins
  2. Receptor Proteins
  3. LDLR Protein, Mouse (HEK293, His)

LDLR Protein crucially binds to LDL, transporting cholesterol through endocytosis. Clustering into clathrin-coated pits initiates internalization. Interactions with DAB2, LDLRAP1, ARRB1, SNX17, and immature PCSK9 contribute to its functional versatility. The NPXY motif interaction is impaired by tyrosine phosphorylation. LDLR Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDLR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LDLR Protein crucially binds to LDL, transporting cholesterol through endocytosis. Clustering into clathrin-coated pits initiates internalization. Interactions with DAB2, LDLRAP1, ARRB1, SNX17, and immature PCSK9 contribute to its functional versatility. The NPXY motif interaction is impaired by tyrosine phosphorylation. LDLR Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDLR protein, expressed by HEK293 , with C-His labeled tag.

Background

The LDLR protein plays a crucial role in binding to LDL, the primary lipoprotein responsible for transporting cholesterol in the bloodstream, and facilitating its internalization into cells through endocytosis. To undergo internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, LDLR interacts with various proteins, including DAB2 and LDLRAP1 through its NPXY motif, with the interaction impaired by tyrosine phosphorylation of the NPXY motif. It also interacts with ARRB1 and SNX17, further contributing to its functional versatility. Furthermore, LDLR interacts with the immature form of PCSK9, aiding in the regulation of LDL cholesterol levels.

Biological Activity

Immobilized Mouse LDLR at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse PCSK9. The ED50 for this effect is 117.3 ng/mL.

  • Immobilized Mouse LDLR at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse PCSK9 . The ED50 for this effect is 117.3 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

P35951 (A22-R790)

Gene ID
Molecular Construction
N-term
LDLR (A22-R790)
Accession # P35951
His
C-term
Protein Length

Extracellular Domain

Synonyms
Low-density lipoprotein receptor; LDLR; LDL Receptor
AA Sequence

AAEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDGDVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPDEFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSGECISLDKVCDSARDCQDWSDEPIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHRCEDIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCLTEVDTVLTTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVSHQVQGDMAGRGNEEQPHGMR

Molecular Weight

Approximately 98-130 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LDLR Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDLR Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73272
Quantity:
MCE Japan Authorized Agent: