1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. LDHB Protein, Human (His)

The LDHB protein, also known as lactate dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. References indicate that the LDHB protein effectively catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. LDHB Protein, Human (His) is the recombinant human-derived LDHB protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LDHB protein, also known as lactate dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. References indicate that the LDHB protein effectively catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. LDHB Protein, Human (His) is the recombinant human-derived LDHB protein, expressed by E. coli , with N-6*His labeled tag.

Background

LDHB protein, also known as Lactate Dehydrogenase B, is an enzyme that plays a crucial role in cellular energy metabolism. LDHB protein efficiently catalyzes the simultaneous, stereospecific interconversion of pyruvate and lactate. This enzymatic activity is accompanied by the reciprocal interconversion of NADH and NAD(+), which are essential coenzymes involved in redox reactions. LDHB helps facilitate the conversion of pyruvate, a product of glycolysis, into lactate, and vice versa. This interconversion process is important for maintaining the balance of lactate and pyruvate in cells and is critical for energy production and the regulation of cellular redox state.

Biological Activity

Measured by its ability to reduce pyruvate to lactate. The specific activity is 101589.5 pmol/min/μg, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P07195 (M1-L334)

Gene ID
Molecular Construction
N-term
6*His
LDHB (M1-L334)
Accession # P07195
C-term
Protein Length

Full Length

Synonyms
rHuL-lactate dehydrogenase B chain/LDH-B, His; L-lactate Dehydrogenase B Chain; LDH-B; LDH Heart Subunit; LDH-H; Renal Carcinoma Antigen NY-REN-46; LDHB
AA Sequence

MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Molecular Weight

Approximately 37.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

LDHB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDHB Protein, Human (His)
Cat. No.:
HY-P70265
Quantity:
MCE Japan Authorized Agent: