1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. LDHA Protein, Rat (His)

The LDHA protein facilitates the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the concomitant exchange of NADH and NAD(+).LDHA Protein, Rat (His) is the recombinant rat-derived LDHA protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LDHA protein facilitates the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the concomitant exchange of NADH and NAD(+).LDHA Protein, Rat (His) is the recombinant rat-derived LDHA protein, expressed by E.coli , with N-His labeled tag.

Background

LDHA Protein, an isoform of lactate dehydrogenase, is vital in cellular metabolism, converting pyruvate to lactate for energy production in anaerobic conditions. Understanding LDHA Protein's functions is crucial for studying metabolic disorders and developing therapies targeting altered metabolism in cancer and other diseases.

Biological Activity

Measured by its ability to reduce pyruvate to lactate. The specific activity is 70337.62058 pmol/min/μg, as measured under the described conditions.

Species

Rat

Source

E. coli

Tag

N-His

Accession

P04642 (M1-F332)

Gene ID
Molecular Construction
N-term
His
LDHA (M1-F332)
Accession # P04642
C-term
Protein Length

Full Length

Synonyms
L-lactate dehydrogenase A chain; LDH-A; LDH-M; Ldha; Ldh-1
AA Sequence

MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF

Molecular Weight

Approximately 38.7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 50 mM NaCl or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LDHA Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDHA Protein, Rat (His)
Cat. No.:
HY-P73271
Quantity:
MCE Japan Authorized Agent: