1. Recombinant Proteins
  2. Others
  3. LCN1/Lipocalin-1 Protein, Human (HEK293, His)

The LCN1/Lipocalin-1 protein may be involved in taste reception and contribute to the concentration and transport of taste molecules in the taste system. LCN1/Lipocalin-1 Protein, Human (HEK293, His) is the recombinant human-derived LCN1/Lipocalin-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LCN1/Lipocalin-1 protein may be involved in taste reception and contribute to the concentration and transport of taste molecules in the taste system. LCN1/Lipocalin-1 Protein, Human (HEK293, His) is the recombinant human-derived LCN1/Lipocalin-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

LCN1 (Lipocalin-1) protein is implicated in taste reception and might play a crucial role in the concentration and delivery of sapid molecules within the gustatory system. Known for its broad ligand-binding capabilities, LCN1 interacts with various ligands, spanning lipids, retinoids, macrocyclic antibiotic rifampicin, and microbial siderophores, owing to its remarkably wide ligand pocket. The protein predominantly exists as a monomer but may also form homodimers. Additionally, LCN1 engages in an interaction with LMBR1L, facilitating the endocytosis of LCN1.

Biological Activity

Measured by its ability to inhibit Cathepsin V cleavage of a fluorogenic peptide substrate Z-LR-AMC. The IC50 value is 49.3 nM.

  • Measured by its ability to inhibit Cathepsin V cleavage of a fluorogenic peptide substrate Z-LR-AMC. The IC50 value is 49.3 nM.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P31025 (H19-D176)

Gene ID
Molecular Construction
N-term
LCN1 (H19-D176)
Accession # P31025
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Lipocalin-1; Tear lipocalin; Tlc; TP; VEG protein; VEGP
AA Sequence

HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Predicted Molecular Mass
18.1 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LCN1/Lipocalin-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LCN1/Lipocalin-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P75905
Quantity:
MCE Japan Authorized Agent: