1. Recombinant Proteins
  2. Receptor Proteins
  3. Layilin/LAYN Protein, Rat (HEK293)

Layilin (LAYN), predicted to bind hyaluronic acid, is expected to function as a membrane integral component. Its biased expression in tissues like the spleen (RPKM 32.4) and lung (RPKM 17.5) underscores Layilin's potential roles in diverse cellular processes across various physiological contexts. Layilin/LAYN Protein, Rat (HEK293) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Layilin (LAYN), predicted to bind hyaluronic acid, is expected to function as a membrane integral component. Its biased expression in tissues like the spleen (RPKM 32.4) and lung (RPKM 17.5) underscores Layilin's potential roles in diverse cellular processes across various physiological contexts. Layilin/LAYN Protein, Rat (HEK293) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with tag free.

Background

Layilin (LAYN) is predicted to possess hyaluronic acid binding activity and is anticipated to serve as an integral component of the cellular membrane. This protein, orthologous to human LAYN (layilin), exhibits biased expression in various tissues, including the spleen (RPKM 32.4) and lung (RPKM 17.5), highlighting its potential involvement in diverse cellular processes and physiological contexts.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Layilin at 5 µg/mL (100 µL/well) can bind biotinylated hyaluronan. The ED50 for this effect is 7.316 µg/mL.

Species

Rat

Source

HEK293

Tag

Tag Free

Accession

NP_001178926.1 (H25-E224)

Gene ID
Molecular Construction
N-term
LAYN (H25-E224)
Accession # NP_001178926.1
C-term
Protein Length

Partial

Synonyms
Layilin; LAYN; LYAN
AA Sequence

HLLSGDLDPRGGQRFCWEGTRRPCYRVIYFHDTSQRRNFEEAKEACMKDGGQLASIETADEQRLIENFIESLQASDGDFWIGLKRLEEKQHNSTACQDLYAWTDGSLSQFRNWYMDEPSCESEVCVVMYHQPSAPPGIGGPYMFQWNDDRCNTKKNFICKYSDDKPSTTPSLSPGGEATEPAAPILPEETLEIDTKERRE

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Layilin/LAYN Protein, Rat (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Layilin/LAYN Protein, Rat (HEK293)
Cat. No.:
HY-P74779
Quantity:
MCE Japan Authorized Agent: