1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. LAIR-1/CD305 LAIR-1/CD305
  5. LAIR1 Protein, Mouse (HEK293, His)

The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The LAIR1 protein operates as an inhibitory receptor, constitutively exerting a negative regulatory influence on the cytolytic function of natural killer (NK) cells, B-cells, and T-cells. Upon activation through tyrosine phosphorylation, LAIR1 recruits and activates phosphatases PTPN6 and PTPN11, leading to downstream inhibitory effects. Notably, it diminishes the increase in intracellular calcium triggered by B-cell receptor ligation. Beyond its role with SH2-containing phosphatases, LAIR1 independently modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG while inducing the secretion of transforming growth factor beta. It further regulates IgG and IgE production in B-cells, as well as the secretion of IL8, IL10, and TNF. LAIR1's impact extends to inhibiting proliferation, inducing apoptosis in myeloid leukemia cell lines, preventing nuclear translocation of NF-kappa-B p65 subunit/RELA, and inhibiting the phosphorylation of I-kappa-B alpha/CHUK in these cells. Moreover, it hinders the differentiation of peripheral blood precursors into dendritic cells. Interaction-wise, LAIR1 associates with the SH2 domains of tyrosine-protein phosphatases PTPN6 and PTPN11 constitutively and binds with high affinity to extracellular matrix collagens, a functionally significant interaction.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8BG84-1 (Q22-Y141)

Gene ID
Molecular Construction
N-term
LAIR1 (Q22-Y141)
Accession # Q8BG84-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Leukocyte-associated immunoglobulin-like receptor 1; LAIR-1; mLAIR-1; CD305; Lair1
AA Sequence

QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTY

Molecular Weight

21-35 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LAIR1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAIR1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70871
Quantity:
MCE Japan Authorized Agent: