1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. LACTB2 Protein, Human (GST)

As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.

Background

LACTB2 protein functions as an endoribonuclease, exhibiting a preference for cleaving single-stranded RNA at 3' to purine-pyrimidine dinucleotide motifs. The resulting cleavage product retains a free 3'-OH group. Notably, LACTB2 lacks activity with double-stranded RNA or DNA. Its role is essential for maintaining normal mitochondrial function and ensuring cell viability. The specific substrate preference and its involvement in RNA cleavage highlight LACTB2's significance in regulating RNA processing within the mitochondria, emphasizing its critical role in cellular and mitochondrial homeostasis. (

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q53H82 (M1-L288)

Gene ID
Molecular Construction
N-term
GST
LACTB2 (M1-L288)
Accession # Q53H82
C-term
Protein Length

Full Length

Synonyms
Beta-Lactamase-Like Protein 2; LACTB2
AA Sequence

MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

Predicted Molecular Mass
59.2 kDa
Molecular Weight

Approximately 56 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LACTB2 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LACTB2 Protein, Human (GST)
Cat. No.:
HY-P70853
Quantity:
MCE Japan Authorized Agent: