1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. L-Selectin/CD62L L-Selectin/CD62L Selectin
  5. L-selectin/CD62L Protein, Human (HEK293, His)

The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-selectin/CD62L Protein, Human (HEK293, His) is the recombinant human-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-selectin/CD62L Protein, Human (HEK293, His) is the recombinant human-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

Background

L-Selectin, also known as CD62L, is a calcium-dependent lectin that plays a crucial role in mediating cell adhesion by binding to glycoproteins on neighboring cells. Functionally, it facilitates the adherence of lymphocytes to endothelial cells within high endothelial venules in peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes in endothelial tissues. L-Selectin's interaction with SELPLG/PSGL1 and PODXL2 is vital for the recruitment and rolling of leukocytes. This interaction is specifically dependent on the sialyl Lewis X glycan modification of SELPLG and PODXL2, along with tyrosine sulfation modifications of SELPLG. Notably, sulfation on 'Tyr-51' of SELPLG emerges as a critical factor for effective L-Selectin binding. The multifaceted functions of L-Selectin underscore its significance in orchestrating cell adhesion processes and immune cell recruitment.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells. The ED50 for this effect is 2.231 μg/mL, corresponding to a specific activity is 448.230 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells.  The ED50 for this effect is 2.231 μg/mL, corresponding to a specific activity is 448.230 units/mg.
Species

Human

Source

HEK293

Tag

C-His

Accession

P14151 (W39-N332)

Gene ID
Molecular Construction
N-term
L-selectin (W39-N332)
Accession # P14151
His
C-term
Synonyms
L-selectin; Sell; CD62 antigen-like family member L; LECAM1; CD62L; LAM-1
AA Sequence

WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN

Molecular Weight

50-75 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

L-selectin/CD62L Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
L-selectin/CD62L Protein, Human (HEK293, His)
Cat. No.:
HY-P74768
Quantity:
MCE Japan Authorized Agent: