KREMEN1 Protein, Human (HEK293, His)

KREMEN1 Protein, Human (HEK293, His) is the recombinant human-derived KREMEN1 protein, expressed by HEK293, with C-His labeled tag.

KREMEN1 is a receptor for Dickkopf proteins that cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. In the absence of DKK1, it potentiates Wnt-beta-catenin signaling by maintaining LRP5 or LRP6 at the cell membrane. KREMEN1 can also trigger apoptosis in a Wnt-independent manner, an activity inhibited upon DKK1 binding. It plays a role in limb development by attenuating Wnt signaling for proper limb patterning and negatively regulates bone formation. Additionally, KREMEN1 modulates cell fate decisions in the developing cochlea, inhibiting hair cell fate specification.

Measured by its binding ability in a functional ELISA. Immobilized human Dkk-1 at 2 μg/mL can bind Human KREMEN1. The ED₅₀ for this effect is 0.315 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized human Dkk-1 at 2 μg/mL can bind Human KREMEN1. The ED₅₀ for this effect is 0.315 μg/mL.

Human

HEK293

C-His

Q96MU8-2/NP_114434.3 (A20-T394)

83999  [NCBI]

Partial

ARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWT

Approximately 60 kDa. The protein migrates as an approximately 60 kDa band under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.