1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. KRAS Protein, Human (G13C, His)

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. KRAS Protein, Human (G13C, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G13C mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. KRAS Protein, Human (G13C, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G13C mutation.

Background

KRAS, a pivotal member of the Ras protein family, exhibits the ability to bind GDP/GTP and possesses intrinsic GTPase activity. Its crucial involvement in the regulation of cell proliferation underscores its significance in cellular processes. Notably, KRAS plays a prominent role in promoting oncogenic events, particularly in colorectal cancer (CRC), where it induces transcriptional silencing of tumor suppressor genes (TSGs) in a ZNF304-dependent manner. This multifaceted functionality highlights KRAS as a key player in cellular dynamics and emphasizes its relevance in both normal and pathological cellular processes.

Biological Activity

Measured by its ability to catalyze the substrate GTP. The specific activity is 2.08 nmol/min/mg, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH13572.1 (T2-C185, G13C)

Gene ID
Molecular Construction
N-term
6*His
KRAS (T2-C185, G13C)
Accession # AAH13572.1
C-term
Protein Length

Partial

Synonyms
Ki-Ras; c-K-ras; KRAS2; RASK2
AA Sequence

TEYKLVVVGAGCVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Weight

Approximately 25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KRAS Protein, Human (G13C, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KRAS Protein, Human (G13C, His)
Cat. No.:
HY-P7804A
Quantity:
MCE Japan Authorized Agent: