1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. Killer Cell Lectin Like Receptor G1 (KLRG1)
  6. KLRG1 Protein, Human (His-SUMO)

KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (His-SUMO) is the recombinant human-derived KLRG1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (His-SUMO) is the recombinant human-derived KLRG1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The KLRG1 protein exhibits an inhibitory role on the functions of natural killer (NK) cells and T-cells by binding to their non-MHC ligands. It is potentially involved in the recognition of "missing self" by binding to a conserved site on classical cadherins, specifically monitoring the expression of E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4 on target cells. KLRG1 forms a monomer and homodimer that are connected by disulfide bonds. Furthermore, it interacts with PTPN11 and INPP5D through its ITIM motif, potentially participating in signal transduction pathways.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q96E93 (L60-F195)

Gene ID
Molecular Construction
N-term
6*His-SUMO
KLRG1 (L60-F195)
Accession # Q96E93
C-term
Synonyms
2F1 Ag; 2F1; C type lectin domain family 15 member A; C-type lectin domain family 15 member A; CLEC15A; KLRG 1; KLRG1; KLRG1 protein
AA Sequence

LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Molecular Weight

Approximately 31.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KLRG1 Protein, Human (His-SUMO)
Cat. No.:
HY-P71607
Quantity:
MCE Japan Authorized Agent: