1. Recombinant Proteins
  2. Others
  3. KLF6 Protein, Human

KLF6 Protein, a transcriptional activator, binds GC box motifs and may contribute to B-cell growth and development. It interacts with ZZEF1. KLF6 Protein, Human is the recombinant human-derived KLF6 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KLF6 Protein, a transcriptional activator, binds GC box motifs and may contribute to B-cell growth and development. It interacts with ZZEF1. KLF6 Protein, Human is the recombinant human-derived KLF6 protein, expressed by E. coli , with tag free.

Background

KLF6, a transcriptional activator, is characterized by its ability to bind to GC box motifs, suggesting its involvement in the regulation of gene expression. With potential implications in B-cell growth and development, KLF6 is likely to contribute to the intricate transcriptional network governing cellular processes. Notably, its interaction with ZZEF1 adds a layer of complexity, hinting at potential regulatory pathways and molecular connections that underscore KLF6's role in cellular functions.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99612-3 (M1-S109)

Gene ID
Molecular Construction
N-term
KLF6 (M1-S109)
Accession # Q99612-3
C-term
Protein Length

Partial

Synonyms
Krueppel-Like Factor 6; B-Cell-Derived Protein 1; Core Promoter Element-Binding Protein; GC-Rich Sites-Binding Factor GBF; Proto-Oncogene BCD1; Suppressor of Tumorigenicity 12 Protein; Transcription Factor Zf9; KLF6; BCD1; COPEB; CPBP; ST12
AA Sequence

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVS

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

KLF6 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KLF6 Protein, Human
Cat. No.:
HY-P70898
Quantity:
MCE Japan Authorized Agent: