1. Recombinant Proteins
  2. Others
  3. KIR3DS1/CD158e2 Protein, Human (CHO, His)

KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO, His) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO, His) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free.

Background

KIR3DS1/CD158e2, situated on natural killer (NK) cells, functions as a receptor for MHC class I molecules. Its pivotal role involves triggering NK cell degranulation and promoting the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. The direct interaction with HLA-F open conformer underscores the specificity of this receptor-ligand engagement, highlighting KIR3DS1/CD158e2 as a key player in modulating NK cell responses, particularly in the context of anti-viral immune reactions.

Biological Activity

Immobilized Human KIR3DS1, at 2 μg/mL (100μL/well) can bind Anti-KIR3DS1 antibody. The ED50 for this effect is 0.9047 μg/mL.

  • Immobilized Human KIR3DS1, at 2 μg/mL (100 μL/well) can bind Anti-KIR3DS1 antibody. The ED50 for this effect is 0.9047 μg/mL.
Species

Human

Source

CHO

Tag

C-6*His

Accession

Q14943-1 (H22-H340)

Gene ID
Molecular Construction
N-term
CD158e2 (H22-H340)
Accession # Q14943
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Killer cell immunoglobulin-like receptor 3DS1; KIR3DS1; Natural killer-associated transcript 10; NKAT-10; NKAT10; Killer Cell Immunoglobulin-like Receptor, Three Domains, Long Cytoplasmic Tail, 1
AA Sequence

HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIR3DS1/CD158e2 Protein, Human (CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR3DS1/CD158e2 Protein, Human (CHO, His)
Cat. No.:
HY-P79142
Quantity:
MCE Japan Authorized Agent: