KGF/FGF-7 Protein, Human

KGF/FGF-7 Protein is an epithelial cell-specific mitogen secreted by normal stromal fibroblasts. KGF/FGF-7 Protein activates plasminogen activator (PA) activity to promote extracellular matrix degradation. KGF/FGF-7 Protein, Human has activities such as promoting the proliferation and differentiation of epithelial cells (such as keratinocytes, thymic epithelial cells), repairing tissue damage (such as intestinal ischemia/reperfusion injury, bone defects), and regulating immune function (such as improving thymus function in aged mice). KGF/FGF-7 Protein, Human is a recombinant KGF/FGF-7 protein expressed by E. coli without a tag.

KGF/FGF-7 Protein belongs to the fibroblast growth factor family^[1]. KGF/FGF-7 Protein is an epithelial cell-specific mitogen secreted by normal stromal fibroblasts^[1]. KGF/FGF-7 Protein stimulates epithelial cell proliferation and migration and regulates differentiation processes by binding to specific receptors on the surface of epithelial cells. For example, under high calcium conditions, it promotes keratinocytes to express early (K1) and late (filagrin) differentiation markers, and activates plasminogen activator (PA) activity to promote extracellular matrix degradation^[1][3]. KGF/FGF-7 Protein is expressed in mesenchymal cells of various tissues such as skin, gastrointestinal tract, lung, and thymus, and acts on epithelial cells through paracrine effects^{[1][2][5][6][7]}. KGF/FGF-7 Protein, Human has activities such as promoting the proliferation and differentiation of epithelial cells (such as keratinocytes and thymic epithelial cells), repairing tissue damage (such as intestinal ischemia/reperfusion injury and bone defects), and regulating immune function (such as improving thymus function in aged mice). For example, it stimulates keratinocyte migration and PA activity in wound repair, and promotes the expression of osteogenic markers and new bone formation in bone defect models^{[1][3][4][5][6][7]}.

KGF/FGF-7 Protein, Human (10 ng/mL; 4 days) promotes human keratinocyte proliferation with an effect comparable to that of EGF^[1].
KGF/FGF-7 Protein, Human (20 ng/mL; 6-48 h) induces increased SCF mRNA and protein secretion in human HaCaT keratinocytes^[2].
KGF/FGF-7 Protein, Human (1 nM; 16 h) significantly stimulates human keratinocyte migration and urokinase-type plasminogen activator (uPA) activity^[3].
KGF/FGF-7 Protein, Human (25-200 ng/mL; 48 h for migration test) stimulates migration of rat bone marrow stromal cells (BMSCs) and increases the expression of SDF-1 and CXCR4^[4].

KGF/FGF-7 Protein, Human (5 mg/kg; s.c.; 3 days; before transplantation) reduces GVHD mortality and improves liver, lung and other organ damage in the B10.BR mouse allogeneic bone marrow transplantation model^[5].
KGF/FGF-7 Protein, Human (5 mg/kg/d; i.p.; 5 days; before surgery) increases intestinal wet weight, reduces epithelial apoptosis, and restores tight junction protein distribution in the intestinal ischemia/reperfusion model of C57BL/6J mice^[6].
KGF/FGF-7 Protein, Human (5 mg/kg/d; s.c.; 3 days) induces thymic regeneration, increases thymocyte number and naive T cell output in C57BL/6J mice^[7].

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells.The ED₅₀ for this effect is ≤110.3 ng/mL, corresponding to a specific activity is ≥9.07×10³ U/mg.

• 
  Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cells.The ED₅₀ for this effect is 15.20 ng/mL, corresponding to a specific activity is 6.6×10⁴ U/mg.

Human

E. coli

Tag Free

P21781-1 (C32-T194)

2252  [NCBI]

Full Length of Isoform-1 Mature Protein

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Approximately 17.6-20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 1mM EDTA, 5% Trehalose, 0.02% Tween 80, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, pH 7.4 or PBS or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween80 or 20 mM PB, 500 mM NaCl, pH 8.0, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Marchese C, et al. Human keratinocyte growth factor activity on proliferation and differentiation of human keratinocytes: differentiation response distinguishes KGF from EGF family. J Cell Physiol. 1990 Aug;144(2):326-32.  [Content Brief]

  [2]. Belleudi F, et al. KGF Promotes Paracrine Activation of the SCF/c-KIT Axis from Human Keratinocytes to Melanoma Cells. Transl Oncol. 2010 Apr;3(2):80-90.  [Content Brief]

  [3]. Tsuboi R, et al. Keratinocyte growth factor (FGF-7) stimulates migration and plasminogen activator activity of normal human keratinocytes. J Invest Dermatol. 1993 Jul;101(1):49-53.  [Content Brief]

  [4]. Poudel SB, et al. Local delivery of recombinant human FGF7 enhances bone formation in rat mandible defects. J Bone Miner Metab. 2017 Sep;35(5):485-496.  [Content Brief]

  [5]. Panoskaltsis-Mortari A, et al. Keratinocyte growth factor administered before conditioning ameliorates graft-versus-host disease after allogeneic bone marrow transplantation in mice. Blood. 1998 Nov 15;92(10):3960-7.  [Content Brief]

  [6]. Cai Y, et al. Keratinocyte growth factor improves epithelial structure and function in a mouse model of intestinal ischemia/reperfusion. PLoS One. 2012;7(9):e44772.  [Content Brief]

  [7]. Min D, et al. Sustained thymopoiesis and improvement in functional immunity induced by exogenous KGF administration in murine models of aging. Blood. 2007 Mar 15;109(6):2529-37.  [Content Brief]