1. Recombinant Proteins
  2. Receptor Proteins
  3. KDELR2 Protein, Mouse (Cell-Free, His)

KDELR2 Protein, a membrane receptor, crucially maintains endoplasmic reticulum (ER) resident proteins' localization. It binds the K-D-E-L sequence motif, retaining these proteins within the ER. This interaction facilitates vesicle-mediated recycling, ensuring proper subcellular localization through Golgi-to-ER protein return. KDELR2's pH-dependent binding, optimal at pH 5-5.4, underscores the regulatory role of pH in this vital cellular process. KDELR2 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KDELR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KDELR2 Protein, a membrane receptor, crucially maintains endoplasmic reticulum (ER) resident proteins' localization. It binds the K-D-E-L sequence motif, retaining these proteins within the ER. This interaction facilitates vesicle-mediated recycling, ensuring proper subcellular localization through Golgi-to-ER protein return. KDELR2's pH-dependent binding, optimal at pH 5-5.4, underscores the regulatory role of pH in this vital cellular process. KDELR2 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KDELR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

KDELR2 Protein, a membrane receptor, functions as a crucial participant in the maintenance of endoplasmic reticulum (ER) resident proteins' localization. The receptor binds to the K-D-E-L sequence motif located in the C-terminal region of these proteins, facilitating their retention within the ER. This interaction is pivotal for the vesicle-mediated recycling process that ensures the return of ER-resident proteins from the Golgi apparatus to the ER, contributing to their proper subcellular localization. Notably, the binding affinity of KDELR2 is pH-dependent, with optimal binding occurring at a slightly acidic pH range of 5-5.4, underscoring the regulatory role of pH in this vital cellular process.

Species

Mouse

Source

E. coli Cell-free

Tag

N-10*His

Accession

Q9CQM2 (M1-A212)

Gene ID

66913

Molecular Construction
N-term
10*His
KDELR2 (M1-A212)
Accession # Q9CQM2
C-term
Protein Length

Full Length

Synonyms
ER lumen protein-retaining receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; KDEL receptor 2
AA Sequence

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Molecular Weight

Approximately 24 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij-78, 6%Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KDELR2 Protein, Mouse (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KDELR2 Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702352
Quantity:
MCE Japan Authorized Agent: