1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-8 Protein, Mouse (P.pastoris, His)

Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Kallikrein-8 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Kallikrein-8 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Kallikrein-8, a serine protease, exhibits the capability to degrade various proteins, including casein, fibrinogen, kininogen, fibronectin, and collagen type IV. Moreover, it cleaves L1CAM in response to heightened neural activity, thereby inducing neurite outgrowth and fasciculation in cultured hippocampal neurons. This protease plays a pivotal role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus, and is essential for memory acquisition and synaptic plasticity. Additionally, Kallikrein-8 is involved in skin desquamation and keratinocyte proliferation, contributing to these processes. Furthermore, it plays a significant role in the secondary phase of pathogenesis following spinal cord injury, underscoring its diverse functions in neural and cutaneous processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

Q61955 (I33-D260)

Gene ID
Molecular Construction
N-term
6*His
Kallikrein-8 (I33-D260)
Accession # Q61955
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Klk8; Nrpn; Prss19Kallikrein-8; mK8; EC 3.4.21.118; Neuropsin; NP; Serine protease 19
AA Sequence

ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD

Molecular Weight

Approximately 32 kDa. The reducing (R) protein migrates as 32 kDa in SDS-PAGE due to glycosylation.

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6%trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Kallikrein-8 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-8 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71832
Quantity:
MCE Japan Authorized Agent: