1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-1 Protein, Mouse (HEK293, His)

Kallikrein-1 protein is a member of the glandular kallikrein family and plays a vital role in enzyme activity by cleaving the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin..This proteolysis is critical for the production of bradykinin, a bioactive peptide involved in multiple physiological processes, including blood pressure regulation, inflammation, and vascular permeability.Kallikrein-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-1 protein is a member of the glandular kallikrein family and plays a vital role in enzyme activity by cleaving the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin..This proteolysis is critical for the production of bradykinin, a bioactive peptide involved in multiple physiological processes, including blood pressure regulation, inflammation, and vascular permeability.Kallikrein-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Kallikrein-1 is a protein belonging to the glandular kallikrein family, and it exhibits proteolytic activity by cleaving Met-Lys and Arg-Ser bonds in kininogen, leading to the release of Lys-bradykinin. This enzymatic activity positions Kallikrein-1 as a key player in the kinin-kallikrein system, a complex pathway involved in the regulation of blood pressure, inflammation, and vascular permeability. By generating Lys-bradykinin, Kallikrein-1 contributes to the production of bradykinin, a potent vasoactive peptide with various physiological effects.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P15947 (P19-D261)

Gene ID
Molecular Construction
N-term
Kallikrein-1 (P19-D261)
Accession # P15947
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuKallikrein-1, His ; Glandular kallikrein K1; KAL-B; Renal kallikrein; Tissue kallikrein-6; mGK-6
AA Sequence

PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND

Predicted Molecular Mass
27.9 kDa
Molecular Weight

Approximately 34-38 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Kallikrein-1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70302
Quantity:
MCE Japan Authorized Agent: