1. Recombinant Proteins
  2. Others
  3. JUN Protein, Human (His, Myc)

JUN Protein, Human (His, Myc) is the recombinant human-derived JUN, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

JUN Protein, Human (His, Myc) is the recombinant human-derived JUN, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

c-Jun is a transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3'. It heterodimerizes with FOS family proteins to form the AP-1 transcription complex, enhancing both DNA binding and transcriptional activity (by similarity). Together with FOSB, it participates in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L and inducing its transcription upon TCR/CD3 signaling pathway activation. When phosphorylated by HIPK3, c-Jun promotes NR5A1 activity, boosting steroidogenic gene expression in response to cAMP pathway stimulation. In colorectal cancer (CRC) cells, it mediates KRAS-activated transcriptional upregulation of USP28 and directly binds to the USP28 promoter. During Epstein-Barr virus (EBV) infection, c-Jun binds to the viral BZLF1 Z promoter to activate BZLF1 expression.

Biological Activity

Immobilized Human JUN Protein at 2 μg/mL (100 μL/well) can bind JUN antibody.The ED50 for this effect is 20-100 ng/mL.

  • Immobilized Human JUN Protein at 2 μg/mL (100 μL/well) can bind JUN antibody.The ED50 for this effect is 24.06 ng/mL.
Species

Human

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P05412 (M1-F331)

Gene ID

3725

Protein Length

Full Length

Synonyms
Activator protein 1; AP1; Proto-oncogene c-Jun; Transcription factor AP-1 subunit Jun; V-jun avian sarcoma virus 17 oncogene homolog; p39
AA Sequence

MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Molecular Weight

Approximately 41-45 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

JUN Protein, Human (His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JUN Protein, Human (His, Myc)
Cat. No.:
HY-P702589
Quantity:
MCE Japan Authorized Agent: