1. Recombinant Proteins
  2. Enzymes & Regulators Biotinylated Proteins
  3. Protein Tyrosine Kinases
  4. JAK2
  5. Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9)

Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9)

Cat. No.: HY-P704597
Handling Instructions Technical Support

The Janus kinase 2 (JAK2) protein is a critical non-receptor tyrosine kinase that drives important cellular processes affecting growth, development, differentiation, and histone modifications. JAK2 plays a role in innate and adaptive immunity, interacting with receptors such as growth hormone, erythropoietin, and interleukins. Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9) is the recombinant human-derived Janus kinase 2/JAK2 protein, expressed by Sf9 insect cells, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Janus kinase 2 (JAK2) protein is a critical non-receptor tyrosine kinase that drives important cellular processes affecting growth, development, differentiation, and histone modifications. JAK2 plays a role in innate and adaptive immunity, interacting with receptors such as growth hormone, erythropoietin, and interleukins. Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9) is the recombinant human-derived Janus kinase 2/JAK2 protein, expressed by Sf9 insect cells, with tag free.

Background

Janus kinase 2 (JAK2) protein, a non-receptor tyrosine kinase, orchestrates critical cellular processes such as cell growth, development, differentiation, and histone modifications. Operating in both innate and adaptive immunity, JAK2 engages with various receptors, including growth hormone, prolactin, leptin, erythropoietin, thrombopoietin, interferons, and interleukins. Upon ligand binding, JAK2 phosphorylates receptor tyrosine residues, creating docking sites for STAT proteins. This initiates a signaling cascade leading to STAT activation, homodimer or heterodimer formation, and nuclear translocation, ultimately promoting gene transcription. In erythropoiesis, for instance, JAK2 activation by erythropoietin induces STAT5-mediated transcription of crucial genes. JAK2 also participates in signaling cascades activated by cellular retinol and mediates angiotensin-2-induced ARHGEF1 phosphorylation. Furthermore, JAK2 plays a role in the cell cycle by phosphorylating CDKN1B and cooperates with TEC to activate FOS transcription. Intriguingly, in the nucleus, JAK2's involvement extends to chromatin regulation through the phosphorylation of histone H3 at Tyr-41, influencing chromatin structure and function.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

O60674 (T842-G1132)

Gene ID

3717

Molecular Construction
N-term
(T842-G1132)
Accession # O60674
C-term
Protein Length

Partial

Synonyms
JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3
AA Sequence

TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG

Predicted Molecular Mass
36.3 kDa
Molecular Weight

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Janus kinase 2/JAK2 Protein, Human (Biotinylated, sf9)
Cat. No.:
HY-P704597
Quantity:
MCE Japan Authorized Agent: