1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. JAM-B/CD322 Immunoglobulin-like Cell Adhesion Molecules
  5. JAM-B/CD322
  6. JAM-B/CD322 Protein, Mouse (HEK293, His)

JAM-B/CD322 protein regulates cellular processes through interactions with JAM3. It aids hematopoietic cell homing and retention in the bone marrow and facilitates leukocyte extravasation. JAM-B is involved in spermatogenesis, inhibits myelination, promotes myocyte fusion, and may contribute to angiogenesis. Its multifunctionality emphasizes its significance in cellular and physiological processes. JAM-B/CD322 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
5 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time
500 μg Ask For Quote & Lead Time
1 mg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

JAM-B/CD322 protein regulates cellular processes through interactions with JAM3. It aids hematopoietic cell homing and retention in the bone marrow and facilitates leukocyte extravasation. JAM-B is involved in spermatogenesis, inhibits myelination, promotes myocyte fusion, and may contribute to angiogenesis. Its multifunctionality emphasizes its significance in cellular and physiological processes. JAM-B/CD322 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Background

JAM-B/CD322 protein functions as a junctional adhesion molecule, orchestrating heterotypic cell-cell interactions with its receptor JAM3 to regulate diverse cellular processes. It plays a crucial role in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow, contributing to their retention on the surface of bone marrow stromal cells. In the context of leukocyte extravasation, JAM-B is central not only to transmigration but also to tethering and rolling of leukocytes along the endothelium, processes dependent on its binding to the integrin alpha-4/beta-1. Furthermore, JAM-B is involved in spermatogenesis, mediating interactions between Sertoli and germ cells and contributing to the anchorage of germ cells onto Sertoli cells, as well as the assembly of cell polarity complexes during spermatid differentiation. Acting as an inhibitory somatodendritic cue, it prevents the myelination of non-axonal parts of neurons. Additionally, JAM-B participates in myocyte fusion during myogenesis and may play a role in angiogenesis. The multifaceted functions of JAM-B underscore its importance in various cellular and physiological processes.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9JI59 (F29-N236)

Gene ID
Molecular Construction
N-term
JAM-A (F29-N236)
Accession # Q9JI59
His
C-term
Synonyms
C21orf43; CD322; JAM2; JAM-B; junctional adhesion molecule B; PRO245
AA Sequence

FSASKDHRQEVTVIEFQEAILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKVMLEVLVAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Weight

Approximately 37 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

JAM-B/CD322 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JAM-B/CD322 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73260
Quantity:
MCE Japan Authorized Agent: