1. Recombinant Proteins
  2. Others
  3. ITM2B Protein, Human (HEK293, His)

The ITM2B protein regulates amyloid beta A4 precursor protein (APP) processing by inhibiting amyloid beta peptide aggregation and fibril deposition. In addition to its effects on the amyloid-β pathway, ITM2B also contributes to neurite outgrowth, affecting neurobiological processes. ITM2B Protein, Human (HEK293, His) is the recombinant human-derived ITM2B protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ITM2B protein regulates amyloid beta A4 precursor protein (APP) processing by inhibiting amyloid beta peptide aggregation and fibril deposition. In addition to its effects on the amyloid-β pathway, ITM2B also contributes to neurite outgrowth, affecting neurobiological processes. ITM2B Protein, Human (HEK293, His) is the recombinant human-derived ITM2B protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ITM2B assumes a regulatory role in the intricate processing of the amyloid-beta A4 precursor protein (APP) and serves as an inhibitor, effectively impeding the aggregation and fibril deposition of amyloid-beta peptides. Beyond its influence on amyloid-beta pathways, ITM2B plays a pivotal role in the induction of neurite outgrowth, contributing to neurobiological processes. Furthermore, ITM2B acts as a protease inhibitor by strategically blocking access of secretases to critical APP cleavage sites. In its mature form (mBRI2), ITM2B serves as a potent modulator of APP processing, resulting in a substantial reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42, thereby highlighting its multifaceted role in cellular homeostasis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9Y287 (Y76-S266 )

Gene ID
Molecular Construction
N-term
ITM2B (Y76-S266 )
Accession # Q9Y287
6*His
C-term
Synonyms
Integral Membrane Protein 2B; Immature BRI2; imBRI2; Protein E25B; Transmembrane Protein BRI; Bri; ITM2B; BRI; BRI2
AA Sequence

YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

Molecular Weight

29-33 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ITM2B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ITM2B Protein, Human (HEK293, His)
Cat. No.:
HY-P70938
Quantity:
MCE Japan Authorized Agent: