1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Irisin Protein, Human/Mouse/Rat (HEK293, His)

Irisin Protein is an important cytokine secreted by muscles during exercise, which has multiple functions such as regulating metabolism and improving health. Irisin Protein, Human/Mouse/Rat (HEK293, His) is a recombinant Irisin Protein expressed by HEK293 and carrying a C-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Irisin Protein, Human/Mouse/Rat (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Irisin Protein is an important cytokine secreted by muscles during exercise, which has multiple functions such as regulating metabolism and improving health. Irisin Protein, Human/Mouse/Rat (HEK293, His) is a recombinant Irisin Protein expressed by HEK293 and carrying a C-6*His tag[1][2][3].

Background

Irisin is a myokine secreted by skeletal muscles that promotes fat metabolism, induces browning of white adipose tissue, participates in liver metabolism, and maintains glucose and lipid homeostasis. Additionally, Irisin can protect the cardiovascular system, skeletal muscles, and exert neuroprotective effects. The main receptor for Irisin is integrin αV/β5, which mediates its actions in tissues such as adipose, liver, and bone[1][2][3].

In Vitro

Irisin Protein (Human/Mouse/Rat; 100 ng/mL; 24 h) inhibits ROS production and MDA levels, enhances SOD activity, and reverses the increased expression of GSDMD-N, NLRP3, cleaved caspase-1 and the increased secretion of IL-1β and IL-18 in high glucose-treated Min6 cells[4].
Irisin Protein (Human/Mouse/Rat; 0-200 ng/mL; 72 h) inhibits tau K18-induced expression of P53, P21, P16 and SA-β-gal activity, as well as reduces the levels of pro-inflammatory factors TNF-α and IL-6 in BV2 microglial cells[5].

In Vivo

Irisin Protein (Human/Mouse/Rat; 0.25 μg/kg; intraperitoneal injection; 8 weeks) exerts a therapeutic effect in a mouse model of type 2 diabetes, restoring islet morphology, increasing the number of β-cells, and improving insulin resistance[4].
Irisin Protein (Human/Mouse/Rat; 250 µg/kg; weekly intraperitoneal injection; 3 months) exhibits neuroprotective effects in P301S transgenic mice, inhibiting microglial senescence and improving cognitive function and synaptic structure in mice[5].

Biological Activity

Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

Species

Mouse; Rat; Human

Source

HEK293

Tag

C-6*His

Accession

Q8NAU1-1 (D32-E143)

Gene ID
Molecular Construction
N-term
Irisin (D32-E143)
Accession # Q8NAU1-1
6*His
C-term
Protein Length

Partial

Synonyms
Fibronectin type III domain-containing protein 5; Fibronectin type III repeat-containing protein 2; Irisin; FNDC5
AA Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Predicted Molecular Mass
12.6 kDa
Molecular Weight

Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Lyophilized from a 0.2 μm filtered solution of PBS, 8% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Irisin Protein, Human/Mouse/Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Irisin Protein, Human/Mouse/Rat (HEK293, His)
Cat. No.:
HY-P70664
Quantity:
MCE Japan Authorized Agent: