1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-τ
  5. Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His)

Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His)

Cat. No.: HY-P71798
Handling Instructions Technical Support

Interferon tau-1 (IFNT1) serves as an important paracrine hormone that initiates maternal recognition of pregnancy. After interacting with endometrial receptors, possibly type I interferon receptors, IFNT1 blocks estrogen receptor expression and prevents estrogen-induced upregulation of oxytocin receptor expression. Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His) is the recombinant bovine-derived Interferon tau-1/IFNT1 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Interferon tau-1 (IFNT1) serves as an important paracrine hormone that initiates maternal recognition of pregnancy. After interacting with endometrial receptors, possibly type I interferon receptors, IFNT1 blocks estrogen receptor expression and prevents estrogen-induced upregulation of oxytocin receptor expression. Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His) is the recombinant bovine-derived Interferon tau-1/IFNT1 protein, expressed by P. pastoris , with N-His labeled tag.

Background

Interferon tau-1 (IFNT1) serves as a paracrine hormone pivotal for initiating maternal recognition of pregnancy. Upon interaction with endometrial receptors, likely type I interferon receptors, IFNT1 plays a crucial role in blocking estrogen receptor expression, effectively impeding the estrogen-induced upregulation of oxytocin receptor expression in the endometrium. This mechanism results in the suppression of pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, thereby preventing the regression of the corpus luteum (luteolysis) and facilitating the maintenance of ovarian cyclicity. Additionally, IFNT1, possibly through a direct impact on prostaglandin synthesis, sustains ovarian progesterone secretion, stimulating the endometrial secretion of nutrients necessary for conceptus growth. Notably, IFNT1 exhibits exceptional antiviral and antiproliferative potency, coupled with low cytotoxicity, high antiluteolytic activity, and immunomodulatory properties. A distinctive feature is its lack of virally inducibility in contrast to other interferons.

Species

Bovine

Source

P. pastoris

Tag

N-His

Accession

P15696 (C24-L195)

Gene ID

317698  [NCBI]

Molecular Construction
N-term
His
IFNT1 (C24-L195)
Accession # P15696
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IFNT1; Interferon tau-1; IFN-tau-1; Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1; TP-1; Trophoblastin
AA Sequence

CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

Molecular Weight

Approximately 21.8 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His)
Cat. No.:
HY-P71798
Quantity:
MCE Japan Authorized Agent: