1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Insulin
  5. Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution)

Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution)

Cat. No.: HY-P71805Y
Handling Instructions Technical Support

Insulin-1 is an important regulator of glucose and can effectively lower blood sugar by increasing cellular permeability to simple sugars, amino acids, and fatty acids.Its effects include accelerating glycolysis, promoting pentose phosphate cycle, and promoting hepatic glycogen synthesis.Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution) is the recombinant mouse-derived Insulin-1/Ins1 protein, expressed by P.pastoris , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Insulin-1 is an important regulator of glucose and can effectively lower blood sugar by increasing cellular permeability to simple sugars, amino acids, and fatty acids.Its effects include accelerating glycolysis, promoting pentose phosphate cycle, and promoting hepatic glycogen synthesis.Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution) is the recombinant mouse-derived Insulin-1/Ins1 protein, expressed by P.pastoris , with N-His, C-Myc labeled tag.

Background

Insulin-1, a key player in glucose regulation, effectively lowers blood glucose levels by enhancing cellular permeability to monosaccharides, amino acids, and fatty acids. Its multifaceted actions include the acceleration of glycolysis, promotion of the pentose phosphate cycle, and facilitation of glycogen synthesis in the liver. Structurally, Insulin-1 exists as a heterodimer comprising a B chain and an A chain, intricately linked by two disulfide bonds. These structural features underscore its crucial role in orchestrating metabolic processes essential for maintaining glucose homeostasis.

Species

Mouse

Source

P. pastoris

Tag

N-His;C-Myc

Accession

P01325 (F25-N108)

Gene ID

16333  [NCBI]

Molecular Construction
N-term
Ins1 (F25-N18)
Accession # P1325
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ins1; Ins-1; Insulin-1
AA Sequence

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

Molecular Weight

Approximately 25 kDa

Purity

Greater than 90 % as determined by SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 20% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/ug, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His, solution)
Cat. No.:
HY-P71805Y
Quantity:
MCE Japan Authorized Agent: