1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. INSL4 Protein, Human (HEK293, His)

The INSL4 protein plays a potentially critical role in the regulation of trophoblast development and bone formation. The specific mechanism of trophoblast development deserves further study. INSL4 Protein, Human (HEK293, His) is the recombinant human-derived INSL4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The INSL4 protein plays a potentially critical role in the regulation of trophoblast development and bone formation. The specific mechanism of trophoblast development deserves further study. INSL4 Protein, Human (HEK293, His) is the recombinant human-derived INSL4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

INSL4 Protein emerges as a potential key player, suggesting its crucial role in trophoblast development and the regulation of bone formation. The specific mechanisms through which INSL4 contributes to the intricate processes associated with trophoblast development remain to be fully elucidated, warranting further investigation into its functional significance in this context. Additionally, its potential involvement in the regulation of bone formation hints at a broader impact on skeletal development. The dual roles proposed for INSL4 underscore its significance in critical biological processes, prompting further research to unravel the precise molecular pathways and regulatory mechanisms through which INSL4 exerts its effects on trophoblast development and bone formation.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14641 (A26-T139)

Gene ID
Molecular Construction
N-term
INSL4 (A26-T139)
Accession # Q14641
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Early Placenta Insulin-Like Peptide; EPIL; Insulin-Like Peptide 4; Placentin; INSL4
AA Sequence

AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT

Molecular Weight

Approximately 9.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

INSL4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
INSL4 Protein, Human (HEK293, His)
Cat. No.:
HY-P70833
Quantity:
MCE Japan Authorized Agent: