1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Activin/Inhibins
  5. Inhibin A
  6. Inhibin alpha chain/INHA Protein, Bovine (His-SUMO)

Inhibin alpha chain/INHA Protein, Bovine (His-SUMO)

Cat. No.: HY-P72295
Handling Instructions Technical Support

Inhibin alpha chain/INHA protein plays a vital role in regulating pituitary function and contributes to the dual regulation of follicle-stimulating hormone secretion and activin. Inhibin alpha chain/INHA Protein, Bovine (His-SUMO) is the recombinant bovine-derived Inhibin alpha chain/INHA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Inhibin alpha chain/INHA Protein, Bovine (His-SUMO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Inhibin alpha chain/INHA protein plays a vital role in regulating pituitary function and contributes to the dual regulation of follicle-stimulating hormone secretion and activin. Inhibin alpha chain/INHA Protein, Bovine (His-SUMO) is the recombinant bovine-derived Inhibin alpha chain/INHA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

Inhibin alpha chain/INHA protein takes center stage in the intricate regulation of pituitary gland function, participating in the dual modulation of follitropin secretion alongside activins. The broader influence of inhibins and activins, where Inhibin A is a key constituent, spans diverse physiological processes, including hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development, and bone growth, contingent upon their subunit composition. Notably, inhibins, represented by Inhibin A, emerge as apparent antagonists to the functions of activins within this multifaceted regulatory network. Structurally, Inhibin A exists as a dimer, intricately linked by one or more disulfide bonds, with its subunit composition comprising alpha and beta-A subunits. This dimeric configuration underscores the complexity of Inhibin A's role, shedding light on its involvement in the finely tuned orchestration of diverse physiological functions.

Species

Bovine

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P07994 (S227-I360)

Gene ID
Molecular Construction
N-term
6*His-SUMO
INHA (S227-I360)
Accession # P07994
C-term
Protein Length

Full Length of Mature Protein

Synonyms
INHA; Inhibin alpha chain
AA Sequence

STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI

Predicted Molecular Mass
30.6 kDa
Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Inhibin alpha chain/INHA Protein, Bovine (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Inhibin alpha chain/INHA Protein, Bovine (His-SUMO)
Cat. No.:
HY-P72295
Quantity:
MCE Japan Authorized Agent: