1. Recombinant Proteins
  2. Others
  3. ING5 Protein, Human (His)

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ING5 protein is a key component of the HBO1 complex and mediates H3K14ac and H4 acetylation. In the MOZ/MORF complex, it exhibits histone H3 acetyltransferase activity and may regulate DNA replication and act as a transcriptional coactivator. ING5 Protein, Human (His) is the recombinant human-derived ING5 protein, expressed by E. coli , with N-His labeled tag.

Background

ING5, an integral component of the HBO1 complex, plays a crucial role in mediating the acetylation of histone H3 at 'Lys-14' (H3K14ac), and, to a lesser extent, histone H4 acetylation. Within the context of the MOZ/MORF complex, which possesses histone H3 acetyltransferase activity, ING5 contributes to chromatin acetylation, potentially regulating DNA replication and serving as a transcriptional coactivator. Functionally, ING5 inhibits cell growth, induces a delay in S-phase progression, and enhances Fas-induced apoptosis, relying on the presence of INCA1. As a versatile participant in distinct complexes, ING5 forms the HBO1 complex with KAT7/HBO1, MEAF6, and a scaffold subunit, influencing H3K14ac specificity, and the MOZ/MORF complex comprising ING5, KAT6A, KAT6B, MEAF6, and a scaffold subunit. Interactions with H3K4me3 and H3K4me2, as well as associations with EP300 and p53/TP53, further underscore the multifaceted roles of ING5 in chromatin modification and cellular processes.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8WYH8-2 (E36-Q84)

Gene ID
Molecular Construction
N-term
His
ING5 (E36-Q84)
Accession # Q8WYH8-2
C-term
Synonyms
Inhibitor of growth protein 5; p28ING5; ING5
AA Sequence

EDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQ

Molecular Weight

Approximately 7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ING5 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ING5 Protein, Human (His)
Cat. No.:
HY-P75887
Quantity:
MCE Japan Authorized Agent: