1. Recombinant Proteins
  2. Receptor Proteins
  3. ILDR2 Protein, Human (HEK293, His)

ILDR2 proteins play multiple roles in cellular processes, participating in ER stress pathways, affecting lipid homeostasis, and affecting insulin secretion. It is involved in maintaining epithelial barrier function and recruiting MARVELD2/trifibrin into tight junctions, emphasizing its role in cellular integrity. ILDR2 Protein, Human (HEK293, His) is the recombinant human-derived ILDR2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ILDR2 proteins play multiple roles in cellular processes, participating in ER stress pathways, affecting lipid homeostasis, and affecting insulin secretion. It is involved in maintaining epithelial barrier function and recruiting MARVELD2/trifibrin into tight junctions, emphasizing its role in cellular integrity. ILDR2 Protein, Human (HEK293, His) is the recombinant human-derived ILDR2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ILDR2 Protein appears to be a multifunctional player with diverse roles in cellular processes. It may be involved in ER stress pathways, exerting effects on lipid homeostasis and insulin secretion, thereby implicating its potential significance in metabolic regulation. Alongside ILDR1 and LSR, ILDR2 is engaged in maintaining the epithelial barrier function by recruiting MARVELD2/tricellulin to tricellular tight junctions, emphasizing its role in cellular integrity. Furthermore, acting as a member of the B7-like protein family expressed on immune cells and inflamed tissue, ILDR2 exhibits T-cell inhibitory activity, suggesting an immunomodulatory function. In the inner ear, it may regulate alternative pre-mRNA splicing through interactions with TRA2A, TRA2B, and SRSF1. The protein's intricate network of interactions, including MARVELD2, OCLN, P4HB, and HSPA5, further underscores its multifaceted nature. Notably, the interaction with HSPA5 stabilizes ILDR2 expression, contributing to its cellular regulation. Understanding the specific mechanisms governing ILDR2's diverse functions could provide valuable insights into its roles in metabolic processes, cellular integrity, immunomodulation, and pre-mRNA splicing regulation.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q71H61 (L21-E186)

Gene ID
Molecular Construction
N-term
ILDR2 (L21-E186)
Accession # Q71H61
6*His
C-term
Synonyms
Angulin-3; C1orf32; Dbsm1; DJ782G3.1; ILDR2; immunoglobulin-like domain containing receptor 2; LISCH-Like
AA Sequence

LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE

Molecular Weight

45-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ILDR2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ILDR2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70864
Quantity:
MCE Japan Authorized Agent: