1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. IL1RAPL1 Protein, Human (HEK293, His)

IL1RAPL1 protein is a multifaceted regulator that may inhibit N-type calcium channels, affecting secretion and presynaptic differentiation. It may activate MAP kinase JNK, suggesting involvement in intracellular signaling. IL1RAPL1 Protein, Human (HEK293, His) is the recombinant human-derived IL1RAPL1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL1RAPL1 protein is a multifaceted regulator that may inhibit N-type calcium channels, affecting secretion and presynaptic differentiation. It may activate MAP kinase JNK, suggesting involvement in intracellular signaling. IL1RAPL1 Protein, Human (HEK293, His) is the recombinant human-derived IL1RAPL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IL1RAPL1 Protein emerges as a multifaceted regulator, potentially influencing secretion and presynaptic differentiation by inhibiting the activity of the N-type voltage-gated calcium channel. Additionally, it may activate the MAP kinase JNK, indicating its potential involvement in intracellular signaling pathways. IL1RAPL1 is implicated in neurite outgrowth, emphasizing its role in neuronal development. Remarkably, during dendritic spine formation, IL1RAPL1 demonstrates bidirectional capabilities, inducing both pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD. The diverse functional roles proposed for IL1RAPL1 underscore its significance in orchestrating complex cellular processes associated with synaptic function, neuronal development, and intracellular signaling pathways, warranting further exploration into its precise molecular mechanisms and broader implications in neuronal biology.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NZN1-1 (L19-T357)

Gene ID
Molecular Construction
N-term
IL1RAPL1 (L19-T357)
Accession # Q9NZN1-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-1 Receptor Accessory Protein-Like 1; IL-1-RAPL-1; IL-1RAPL-1; IL1RAPL-1; Oligophrenin-4; Three Immunoglobulin Domain-Containing IL-1 Receptor-Related 2; TIGIRR-2; X-Linked Interleukin-1 Receptor Accessory Protein-Like 1; IL1RAPL1; OPHN4
AA Sequence

LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

Molecular Weight

50-70 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL1RAPL1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL1RAPL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70923
Quantity:
MCE Japan Authorized Agent: