1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-7
  5. IL-7 Protein, Mouse (HEK293, His)

IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. IL-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. IL-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IL-7, a hematopoietic cytokine, plays a pivotal role in the development, expansion, and survival of both naive and memory T-cells and B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are mediated through a receptor complex consisting of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, such as JAK1 or JAK3, depending on the cell type, leading to the propagation of signals through downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5. This interaction with its receptor components IL7R and CSF2RG is central to the diverse cellular responses elicited by IL-7.

Biological Activity

1.Mouse IL-7RA-Fc can bind Mouse IL-7-His with an affinity constant of 18.9 nM.
2.Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL).The ED50 for this effect is 60-1000 pg/mL.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P10168/Q544C8/NP_032397.1 (E26-I154)

Gene ID
Molecular Construction
N-term
IL-7 (E26-I154)
Accession # P10168/Q544C8/NP_032397.1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF
AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Molecular Weight

22-28 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

IL-7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70566
Quantity:
MCE Japan Authorized Agent: