1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-7
  5. IL-7 Protein, Mouse (CHO, His)

IL-7 Protein, Mouse (CHO, His) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-7 Protein, Mouse (CHO, His) is constitutively produced by stromal cells from the bone marrow and thymus, plays a crucial role in B cell lymphopoiesis and in T cell homeostasis.

Background

Interleukin-7 (IL-7) is a nonredundant cytokine produced by nonlymphoid cells that is essential for T-cell development in humans and mice and B-cell development in mice. IL-7 contributes to the maintenance of the size and subset composition of the peripheral T-cell pool by providing growth and survival signals through the IL-7 receptor. The IL-7 receptor has a private α-chain and shares the common γ-chain (γc) with other common cytokine receptor users, such as IL-2, IL-4, IL-15, and IL-21. IL-7 together with these cytokines regulates the expansion and contraction of adaptive immune responses and potentially the memory response to a given antigen. IL-7 modulates memory CD8+ T cells in response to a virus infection and, given in conjunction with adoptive transfer of T cells after herpes simplex virus type 1 infection, improves virus clearance[1].

Biological Activity

The ED50 is <0.4 ng/mL as measured by 2E8 cells.

Species

Mouse

Source

CHO

Tag

C-His

Accession

P10168/Q544C8/NP_032397.1 (E26-I154)

Gene ID
Molecular Construction
N-term
IL-7 (E26-I154)
Accession # P10168/Q544C8/NP_032397.1
C-term
Synonyms
rMuIL-7; LP-1; pre-B cell factor
AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSIHHHHHH

Molecular Weight

8-28 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-7 Protein, Mouse (CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-7 Protein, Mouse (CHO, His)
Cat. No.:
HY-P7082
Quantity:
MCE Japan Authorized Agent: