1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-7
  5. IL-7 Protein, Human

IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.

Background

Recombinant Human Interleukin-7 (r-hIL-7) has a central role in T-cell development and survival and enhances immune recovery in murine models of allo-hematopoietic stem cell transplantation (allo-HSCT). Recombinant Human Interleukin-7 induces a doubling in CD4+ and CD8+ T cells. The main effect of IL-7 is an expansion of effector memory T cells. r-hIL-7 can enhance immune recovery after a T cell–depleted allo-HSCT without causing significant GVHD or other serious toxicity[1].

Biological Activity

1.The ED50 is <0.5 ng/mL as measured by murine 2E8 cells, corresponding to a specific activity of >2.0 × 106 units/mg.
2.Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is 0.02-0.08 ng/mL.
3.Measured in a cell proliferation assay using Jurkat cells. The ED50 for this effect is <0.5 ng/mL.

  • Measured in a cell proliferation assay using Jurkat cells. The ED50 for this effect is 0.4102 ng/mL, corresponding to a specific activity is 2.438×106 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P13232-1 (D26-H177)

Gene ID
Molecular Construction
N-term
IL-7 (D26-H177)
Accession # P13232
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
rHuIL-7; LP-1; pre-B cell factor
AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Predicted Molecular Mass
17.5 kDa
Molecular Weight

Approximately 17-20 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-7 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-7 Protein, Human
Cat. No.:
HY-P7045
Quantity:
MCE Japan Authorized Agent: