1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins
  3. Interleukin & Receptors T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Epithelial cell CD Proteins Cytokine Receptors
  4. IL-6R IL-6RA/CD126 IL-6RA/CD126
  5. IL-6RA/CD126
  6. IL-6R alpha Protein, Mouse (HEK293, His)

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway. IL-6R alpha, Mouse consists of 460 amino acids (M1-R460) with two fibronectin type-III-like domains contained in the N-terminal part (109-214 a.a, 215-313 a.a). Soluble IL-6R (sIL-6R) can be detected in the cerebrospinal fluid, conducts trans signaling by binding IL-6 and dimerized gp130, and exhibits a immune tissue expression property. IL-6R alpha Protein, Mouse (HEK293, His) is soluble form and produced in HEK293 cells with a C-Terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Mouse consists of 460 amino acids (M1-R460) with two fibronectin type-III-like domains contained in the N-terminal part (109-214 a.a, 215-313 a.a). Soluble IL-6R (sIL-6R) can be detected in the cerebrospinal fluid, conducts trans signaling by binding IL-6 and dimerized gp130, and exhibits a immune tissue expression property. IL-6R alpha Protein, Mouse (HEK293, His) is soluble form and produced in HEK293 cells with a C-Terminal His-tag.

Background

IL-6 acts as both inflammatory factor and anti-inflammatory factor, fuels cancer progression through activating a series of downstream signalling cascade including gp130 (dimers), JAK/STAT, MAPK, and Akt[1][2].
IL-6R alpha (IL-6Rα) as a part of the receptor for interleukin 6, is a type I transmembrane glycoprotein, which forms a complex with the type I transmembrane signal transducer Glycoprotein 130 (CD130) and regulates the biological activity of IL-6 with a low affinity[3].
The sequence of amino acids in IL-6R alpha proteins of mouse is very different from human (54.07%), but shows high similarity with rat (89.3%).
IL-6R alpha has 2 isoform including mIL6R (the longer one) or sIL6R (the shorter one):
The mIL6R is membrane-bound interleukin-6 receptor, has the potential to drive naive CD4+ T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells[4].
The sIL-6R is soluble interleukin-6 receptor subunit, cleaved from IL-6R alpha (IL-6Rα) in activated CD4+ T cells by proteolysis, and serves as IL-6 agonist. sIL-6R binds membrane-bound IL6R and subunit IL6ST to activate regenerative and anti-inflammatory signal via IL-6 trans signaling and promotes pro-inflammatory properties of IL-6. The hydrolysis of IL-6R alpha is also called ectodomain shedding[1].
IL-6R alpha involves in regulating cell growth and differentiation, and plays an important role in regulation of immune response, acute-phase reactions and hematopoiesis[5].
However, IL-6R alpha shows tissue expression specificity in liver and some cells of the immune system, thus results a limitation of IL6 signaling[6].
It's worth noting that IL-6R alpha dysregulation is implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases, and prostate cancer[7][8].

In Vitro

IL-6R (mSR323) (10 ng/mL; 60 min; room temperature) binds MR16-1, the IL-6R antibody, with the N-terminal half of the fibronectin domain II in COS-7 cells[1].

In Vivo

sIL-6R (mIL-6R α) achieves accelerated regeneration of the axotomized nerve in transgenic mice constitutively expressing both IL-6 and IL-6R, compared with nontransgenic controls[2].
IL-6 signal may play an important role in nerve regeneration after trauma in vivo[2].
sIL-6R (mIL-6R α), causes nodular regenerative hyperplasia and adenomas of the liver in over-expressing double IL-6/sIL-6R transgenic mice[3].

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 3.014 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 3.32×105 units/mg.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 3.014 ng/mL in the presence of 2 ng/mL recombinant mouse IL-6, corresponding to a specific activity is 3.32×105 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P22272 (L20-P364)

Gene ID
Protein Length

Extracellular Domain

Synonyms
Interleukin-6 receptor subunit alpha; IL-6R-alpha; IL-6R 1; sIL6R; CD126
AA Sequence

LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLP

Molecular Weight

approximately 50-65 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-6R alpha Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-6R alpha Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72538
Quantity:
MCE Japan Authorized Agent: