1. Recombinant Proteins
  2. Biotinylated Proteins
  3. IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi)

IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi)

Cat. No.: HY-P704140
Handling Instructions Technical Support

IL-6 is a cytokine with multiple functions in immunity, tissue regeneration, and metabolism, coordinating complex signaling. Binding to IL6R initiates the IL6 signaling pathway through a complex with the signaling subunit IL6ST/gp130. IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived IL-6 protein, expressed by HEK293, with N-His and N-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-6 is a cytokine with multiple functions in immunity, tissue regeneration, and metabolism, coordinating complex signaling. Binding to IL6R initiates the IL6 signaling pathway through a complex with the signaling subunit IL6ST/gp130. IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived IL-6 protein, expressed by HEK293, with N-His and N-Avi labeled tag.

Background

IL-6, a cytokine boasting a diverse array of biological functions spanning immunity, tissue regeneration, and metabolism, engages in a sophisticated signaling orchestration. Upon binding to IL6R, the resulting complex orchestrates the intracellular IL6-signaling pathway through its association with the signaling subunit IL6ST/gp130. Interactions with membrane-bound IL6R and IL6ST prompt 'classic signaling,' whereas binding of IL6 to soluble IL6R and IL6ST elicits 'trans-signaling.' Furthermore, 'cluster signaling' unfolds as membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on adjacent receiver cells. IL-6 serves as a potent inducer of the acute phase response, rapidly contributing to host defense during infection and tissue injury, yet its overproduction is implicated in disease pathology. In the innate immune response, IL-6 synthesis by myeloid cells, including macrophages and dendritic cells, is triggered upon pathogen recognition through toll-like receptors (TLRs) at the infection or injury site. Crucially, in the adaptive immune response, IL-6 is indispensable for the differentiation of B cells into immunoglobulin-secreting cells, a pivotal player in the differentiation of CD4(+) T cell subsets, and a key factor in the development of T follicular helper (Tfh) cells crucial for germinal-center induction. Additionally, IL-6 is required to drive naive CD4(+) T cells toward the Th17 lineage and plays a crucial role in the proliferation of myeloma cells and the survival of plasmablast cells.

Species

Cynomolgus

Source

HEK293

Tag

N-Avi;N-8*His

Accession

P79341 (A28-M212)

Gene ID

102138971

Molecular Construction
N-term
8*His
Avi
IL-6 (A28-M212)
Accession # P79341
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IFN-beta-2; IL6; IL-6; BSF-2; CDF; MGI-2A; Interleukin-6; HSF; IFNB2; HGF; IFN-β-2
AA Sequence

APVLPGEDSKDVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Predicted Molecular Mass
23.9 kDa
Molecular Weight

Approximately 27-35 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

Greater than 95% as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-6 Protein, Cynomolgus (Biotinylated, HEK293, His, Avi)
Cat. No.:
HY-P704140
Quantity:
MCE Japan Authorized Agent: