1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. CSF & Receptors Stem Cell CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. IL-3R alpha/CD123
  5. IL-3R alpha/CD123 Protein, Human (HEK293, His)

IL-3R alpha/CD123 Protein, Human (HEK293, His)

Cat. No.: HY-P70468
Handling Instructions Technical Support

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IL-3R alpha/CD123 Protein serves as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, exerting control over the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, it rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins, including JAK2 and PI3K. These activated pathways play a crucial role in signaling cell proliferation and differentiation. JAK2 activation further initiates a STAT5-mediated transcriptional program, contributing to the regulation of cellular functions. The receptor interacts with its ligand, IL3, and forms a heterodimer consisting of an alpha and a beta subunit. Notably, the beta subunit is shared among the receptors for IL3, IL5, and GM-CSF.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 is present at 1 μg/mL can bind Recombinant IL-3 R alpha /CD123. The ED50 for this effect is ≤33.72 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human IL-3 protein is represent at 1 µg/mL (100 µL/mL) can bind Recombinant Human IL-3R alpha Protein. The ED50 for this effect is 20.44 ng/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P26951-1 (T19-R305)

Gene ID
Molecular Construction
N-term
IL-3Rα (T19-R305)
Accession # P26951-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; CD123
AA Sequence

TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Molecular Weight

Approximately 40-72 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3R alpha/CD123 Protein, Human (HEK293, His)
Cat. No.:
HY-P70468
Quantity:
MCE Japan Authorized Agent: