IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His)

IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation. IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

The IL-3R alpha/CD123 Protein is a crucial member of the type I cytokine receptor family, specifically categorized within the Type 5 subfamily, emphasizing its pivotal role in mediating cellular responses to various cytokines. As part of this receptor family, IL-3R alpha/CD123 likely shares conserved structural and functional features with related receptors, underscoring its involvement in transducing signals from specific type I cytokines. The classification within the type I cytokine receptor family underscores its specific designation within the broader context of cell signaling, providing insights into its unique contributions to hematopoiesis and immune regulation. The study of IL-3R alpha/CD123 contributes to our understanding of its role in physiological processes, offering potential applications in therapeutic interventions for conditions related to hematopoietic disorders and immune dysregulation. Further exploration of IL-3R alpha/CD123's role holds promise for enhancing our knowledge of its contributions to both normal cellular function and pathological conditions.

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Monkey IL-3R alpha protein is represent at 1 µg/mL (100 µg/mL) can bind Recombinant Human IL-3 Protein. The ED₅₀ for this effect is 14.83 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Monkey IL-3R alpha protein is represent at 1 µg/mL (100 µg/mL) can bind Recombinant Human IL-3 Protein. The ED₅₀ for this effect is 14.83 ng/mL.

Cynomolgus

HEK293

C-6*His

G8F3K3 (R18-R302)

102138639

Partial

RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSR

50-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.