1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36β
  6. IL-36 beta/IL-1F8 Protein, Human (153a.a)

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP. IL-36 beta/IL-1F8 Protein, Human (153a.a) is the recombinant human-derived IL-36 beta/IL-1F8 protein, expressed by E. coli , with tag free. The total length of IL-36 beta/IL-1F8 Protein, Human (153a.a) is 153 a.a., with molecular weight of ~ 17.2 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36 beta/IL-1F8 protein signals through IL-36R, activates NF-kappa-B and MAPK pathways, and induces pro-inflammatory responses. It is present in the epithelial barrier and shares the IL-1 system coreceptor IL1RAP. IL-36 beta/IL-1F8 Protein, Human (153a.a) is the recombinant human-derived IL-36 beta/IL-1F8 protein, expressed by E. coli , with tag free. The total length of IL-36 beta/IL-1F8 Protein, Human (153a.a) is 153 a.a., with molecular weight of ~ 17.2 kDa.

Background

IL-36 beta/IL-1F8 protein is a cytokine that binds to and activates the IL1RL2/IL-36R receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells, resulting in a pro-inflammatory response. It is part of the IL-36 signaling system, which is believed to be present in epithelial barriers and involved in local inflammatory responses, similar to the IL-1 system. IL-36 beta stimulates the production of interleukin-6 and interleukin-8 in various cell types, including synovial fibroblasts, articular chondrocytes, and mature adipocytes. It also induces the expression of antimicrobial peptides and matrix metalloproteases. In the skin, IL-36 beta acts on keratinocytes, dendritic cells, and indirectly on T-cells to promote tissue infiltration, cell maturation, and cell proliferation. In cultured keratinocytes, IL-36 beta induces the expression of chemokines and pro-inflammatory cytokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, CXCL1, TNF-alpha, IL-8, and IL-6. It interacts with the cargo receptor TMED10, facilitating its translocation from the cytoplasm into the ERGIC and subsequent secretion.

Biological Activity

Measured by its ability to induce IL-8 secretion by A431 human epithelial carcinoma cells. The ED50 for this effect is 7.502 ng/mL. Corresponding to a specific activity is 1.33×10^5 U/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NZH7-2 (R5-E157)

Gene ID
Molecular Construction
N-term
IL-36β (R5-E157)
Accession # Q9NZH7-2
C-term
Protein Length

Full Length of Isoform 2 Mature Protein

Synonyms
Family of interleukin 1 eta; FIL1 ETA; ; FIL1; FIL1 eta; FIL1H; FILI-ETA; ; IL 1F8 FIL1 eta; IL 1F8; IL 1H2; IL-1 eta; IL-1F8; IL-1H2; IL1 ETA; IL1F8 Canonical product IL 1F8a; ; IL1F8; IL1F8_HUMAN; IL1H2; IL36 beta; IL36B; Interleukin 1 family, member 8 eta; ; Interleukin 1 family, member 8; Interleukin 1 homolog 2; Interleukin 1 Superfamily e; Interleukin 36 beta; Interleukin-1 eta; Interleukin-1 family member 8; Interleukin-1 homolog 2; MGC126880; MGC126882; OTTMUSP00000012797; RP23-176J12.1
AA Sequence

REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Predicted Molecular Mass
17.2 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 40 mM PB, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-36 beta/IL-1F8 Protein, Human (153a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36 beta/IL-1F8 Protein, Human (153a.a)
Cat. No.:
HY-P71862
Quantity:
MCE Japan Authorized Agent: