1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36β
  6. IL-36 beta/IL-1F8 Protein, Human

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 beta/IL-1F8 Protein, Human is a recombinant human IL-36 beta without any tag, which is produced in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 beta/IL-1F8 Protein, Human is a recombinant human IL-36 beta without any tag, which is produced in E. coli.

Background

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta is expressed in monocytes, T/B-lymphocytes, bone-marrow, tonsils, heart, lung, testis, colon, neuron cells, glial cells[3].
The sequence of amino acids in IL-36 beta differs in different species. Human IL-36 beta shares <40% aa sequence identity with mouse.
L-36 beta binds to IL-36R and recruits the co-receptor IL-1RAcP. So that heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways[1]. But the activation requires N-terminal cleavage at Arg5 by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[2]. IL-36β plays a role cell maturation in human bone marrow mononuclear cells and DC cells. IL-36β is associated with the development of inflammatory bowel disease (IBD). The serum levels of IL36β are usually higher in patients with IBD[4].
IL-36 beta is a pro-inflammatory factor. IL-36 beta mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[2].

In Vitro

IL-36 beta (human) (10 μg/mL, 24 h) induces the gene expression of themselves and other family members in keratinocytes[5].
IL-36 beta (human) (10-500 ng/mL) increases IL-36R mRNA level in human blood lymphocytes[6].
IL-36 beta (human) (100 ng/mL, 48 h) induces early proliferation of IL-36R expressing CD4+ T helper cells[6].

Biological Activity

Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 534.89 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NZH7-2 (M1-E157)

Gene ID
Protein Length

Full Length of Isoform 2

Synonyms
Interleukin-36 beta; FIL1 eta; IL-1 eta; IL-1F8; IL-1H2; IL36B
AA Sequence

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Predicted Molecular Mass
17.7 kDa
Molecular Weight

Approximately 18 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-36 beta/IL-1F8 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-36 beta/IL-1F8 Protein, Human
Cat. No.:
HY-P72545
Quantity:
MCE Japan Authorized Agent: