1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-33
  5. IL-33 Protein, Rhesus macaque (His)

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-33 belongs to the IL-1 family and is characterized by its high divergence.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL-33 at 5 μg/mL (100 μL/well) can bind biotinylated Human IL-1RL1. The ED50 for this effect is 148.3 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL-33 at 5 μg/mL (100 μL/well) can bind biotinylated Human IL-1RL1. The ED50 for this effect is 148.3 ng/mL.
Species

Rhesus Macaque

Source

E. coli

Tag

N-6*His

Accession

F7DLG4 (S112-I270)

Gene ID
Molecular Construction
N-term
6*His
IL-33 (S112-I270)
Accession # F7DLG4
C-term
Protein Length

Partial

Synonyms
Interleukin-33; IL-33; IL-1F11; NF-HEV; IL33; C9orf26
AA Sequence

SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRPFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI

Predicted Molecular Mass
20.3 kDa
Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-33 Protein, Rhesus macaque (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-33 Protein, Rhesus macaque (His)
Cat. No.:
HY-P72548
Quantity:
MCE Japan Authorized Agent: