1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-33
  5. IL-33 Protein, Cynomolgus

IL-33 Protein is a cytokine belonging to the IL-1 superfamily. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. IL-33 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-33 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-33 Protein is a cytokine belonging to the IL-1 superfamily. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. IL-33 Protein, Cynomolgus is the recombinant cynomolgus-derived IL-33 protein, expressed by E. coli , with tag free.

Background

Interleukin-33 (IL-33) is a cytokine belonging to the IL-1 superfamily and it main sources include human endothelial cells and mouse adventitial stromal cells of the vascular tree; epithelial cells in barrier tissues; fibroblast reticular cells (FRCs) in the lymphoid organs; and glial cells, neurons, and astrocytes in the nervous system. IL-33 induces helper T cells, mast cells, eosinophils and basophils to produce type 2 cytokines. IL-33 acts intracellularly as a nuclear factor and extracellularly as a cytokine. As a cytokine, IL-33 mediates its biological effects via IL-1 receptor ST 2, activates NF-kappaB and MAP kinases, and drives production of T(H)2-associated cytokines from in vitro polarized T(H)2 cells. In vivo, IL-33 induces the expression of IL-4, IL-5, and IL-13 and leads to severe pathological changes in mucosal organs. Cellular stress or exposure to inflammation can augment or induce cellular expression of IL-33. IL-33 exhibits pleiotropic functions supporting IFN-γ-, IL-9-, and IL-17-dominated immune responses as part of the host response to pathogens or immune-mediated inflammatory diseases[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus IL-33 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Recombinant Human IL1RL1 Protein. The ED50 for this effect is 55.8 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus IL-33 Protein is immobilized at 5 µg/mL (100 µL/well) can bind Recombinant Human IL1RL1 Protein. The ED50 for this effect is 55.8 ng/mL.
Species

Cynomolgus

Source

E. coli

Tag

Tag Free

Accession

A0A2K5W3I1/XP_005581824 (S112-I270)

Gene ID
Molecular Construction
N-term
IL-33 (S112-I270)
Accession # A0A2K5W3I1/XP_005581824
C-term
Protein Length

Partial

Synonyms
Interleukin-33; IL-33; IL-1F11; NF-HEV; DVS 27
AA Sequence

SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSSESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRSFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI

Predicted Molecular Mass
17.9 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-33 Protein, Cynomolgus Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-33 Protein, Cynomolgus
Cat. No.:
HY-P73883
Quantity:
MCE Japan Authorized Agent: