1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-33
  5. IL-33 Protein, Canine

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-33 Protein, Canine

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-33 Protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells, acting as a chemoattractant for Th2 cells. IL-33 preserves Krebs cycle integrity, reducing reactive oxygen species production. In quiescent endothelial cells, IL-33 acts as a transcriptional repressor, but is lost upon angiogenic or pro-inflammatory activation. IL-33 Protein, Canine is the recombinant canine-derived IL-33 protein, expressed by E. coli , with N-Met labeled tag.

Background

IL-33 Protein is a cytokine that binds to and activates the IL1RL1/ST2 receptor, leading to the activation of NF-kappa-B and MAPK signaling pathways in target cells. It plays a role in the maturation of Th2 cells and induces the secretion of T-helper type 2-associated cytokines. IL-33 is also involved in the activation of mast cells, basophils, eosinophils, and natural killer cells. It acts as a chemoattractant for Th2 cells and may function as an 'alarmin', amplifying immune responses during tissue injury. Additionally, IL-33 induces rapid mitochondrial rewiring via UCP2, reducing the generation of reactive oxygen species and preserving the integrity of the Krebs cycle, which is essential for the production of itaconate and subsequent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelial cells, IL-33 is constitutively and abundantly expressed in its uncleaved form, acting as a chromatin-associated nuclear factor with transcriptional repressor properties and sequestering nuclear NF-kappaB/RELA, resulting in lower expression of its target genes. However, this form is rapidly lost upon angiogenic or pro-inflammatory activation.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized IL-33 Protein, Canine at 10 μg/mL (100 μL/well) can bind human IL1R4-Fc and the EC50 is 0.25-0.66 μg/mL.

Species

Canine

Source

E. coli

Tag

Tag Free

Accession

O97863 (S110-S263)

Gene ID
Molecular Construction
N-term
Met
IL-33 (S110-S263)
Accession # O97863
C-term
Protein Length

Partial

Synonyms
Interleukin-33; IL-33; IL-1F11; NF-HEV; DVS 27
AA Sequence

SIQEYSASLSTYNDQSITFVFEDGSYEIYVEDLRKGQEKDKVLFRYYDSQSPSHETGDDVDGQTLLVNLSPTKDKDFLLHANNEEHSVELQKCENQLPDQAFFLLHRKSSECVSFECKNNPGVFIGVKDNHLALIKVGDQTKDSYIEKTIFKLS

Predicted Molecular Mass
17.8 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-33 Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-33 Protein, Canine
Cat. No.:
HY-P73210
Quantity:
MCE Japan Authorized Agent: