1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Rhesus macaque (His)

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-3, a hematopoietic cytokine, exerts regulatory control over hematopoiesis by influencing the production, differentiation, and function of distinct white blood cell populations, including granulocytes, monocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils, and megakaryocytes. Acting as a colony-stimulating factor, IL-3 plays a crucial role in promoting the development and maturation of these various cell types within the blood, contributing to the maintenance of a functional and balanced immune system.

Biological Activity

Measured in a cell proliferation assay using using TF1 human human erythroleukemic cells.The ED50 for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×106 units/mg.

  • Measured in a cell proliferation assay using TF1 human erythroleukemic cells.The ED50 for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×106 units/mg.
Species

Rhesus Macaque

Source

E. coli

Tag

N-6*His

Accession

P25140 (A20-Q143)

Gene ID
Molecular Construction
N-term
6*His
IL-3 (A20-Q143)
Accession # P25140
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL3; Interleukin-3; IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor
AA Sequence

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Predicted Molecular Mass
14 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-3 Protein, Rhesus macaque (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Rhesus macaque (His)
Cat. No.:
HY-P71858A
Quantity:
MCE Japan Authorized Agent: