1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Mouse (HEK293)

IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts. It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes. In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation. IL-3 Protein, Mouse (HEK293) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts. It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes. In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation. IL-3 Protein, Mouse (HEK293) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with tag free.

Background

The cytokine IL-3, predominantly secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, plays a crucial role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Moreover, IL-3 stimulates mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond its hematopoietic functions, IL-3 contributes to neural cell proliferation and survival and participates in bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and a signal transducing subunit IL3RB, leading to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Additionally, IL-3, as a monomer, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK.

Biological Activity

Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells and the ED50 is 0.1-0.5 ng/mL.

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P01586 (A27-C166)/NP_034686.2

Gene ID
Molecular Construction
N-term
IL-3 (A27-C166)/NP_034686.2
Accession # P01586
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-3; IL-3; MCGF
AA Sequence

MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Molecular Weight

Approximately 15.7 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-3 Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3 Protein, Mouse (HEK293)
Cat. No.:
HY-P73207
Quantity:
MCE Japan Authorized Agent: