1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors NK Cell CD Proteins
  4. IL-2 Receptor IL-2R beta/CD122
  5. IL-2R beta/CD122
  6. IL-2R beta/CD122 Protein, Mouse (HEK293, His)

IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately). IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells. IL-2R beta/CD122 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R beta with a C-Terminal 6*His tag, which is produced in HEK 293.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately)[1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R beta with a C-Terminal 6*His tag, which is produced in HEK 293.

Background

IL-2R beta (CD122) is a type I cytokine receptor, and belongs to Type 4 subfamily. IL-2R beta is also a key component of the IL-15 receptor. IL-2R beta is broadly expressed in spleen, blood, and lymph node, such as B and T lymphocytes[1][3].
The sequence of amino acids in IL-2R beta differs in different species. Mouse IL-2R beta shares 81.01% aa sequence identity with rats. Human IL-2R beta shares <60% aa sequence identity with mouse and rats.
IL-2R beta cytoplasmic domain heterodimerizes with IL-2 and leads to the activation of signaling pathways: phosphoinositol 3-kinase (PI3-K)/AKT, Ras-MAP kinase, and the JAK-STAT pathways[4]. IL-2R beta binds IL-2 with intermediate affinity. IL-2R beta mediates IL-2 internalization and signal transduction, such as cell proliferation or differentiation[5]. IL-2R beta interacts with IL-2 and increases the proportion of CD4+ T lymphocytes[1]. IL-2R stimulates T cell proliferation and activating lymphokine-activated killer cells[2].
IL-2R beta mediates T cell immune responses, and also mediates endocytosis, as well as transducing the mitogenic signals of IL-2.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P16297 (A27-E240)

Gene ID
Molecular Construction
N-term
IL-2R beta/CD122 (A27-E240)
Accession # P16297
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-2 receptor subunit beta; IL-2RB; p70-75; CD122
AA Sequence

AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Molecular Weight

40-60 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-2R beta/CD122 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-2R beta/CD122 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72549
Quantity:
MCE Japan Authorized Agent: