1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins
  4. IL-2 Receptor IL-2R alpha/CD25 IL-2R alpha/CD25
  5. IL-2R alpha/CD25
  6. IL-2R alpha/CD25 Protein, Mouse (HEK293, His)

IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions.IL-2R alpha/CD25 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions[1][2].IL-2R alpha/CD25 Protein, Mouse (HEK293, His) is a recombinant mouse IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells.

Background

IL-2R alpha (CD25) is a type I membrane protein. IL-2R alpha is expressed in peripheral activated T and B cells, triple-negative thymocytes, and bone marrow pre-B cells. In high tumor regulatory T (Treg) cells, IL-2R alpha is highly expressed and is a potential target for Treg deletion. The expression of IL-2R alpha is undetectable on resting T cells[1][2][3].
The sequence of amino acids in IL-2R alpha from different species is very different (less than 85% similarity among human, rat and mouse).
IL-2R alpha is an essential component of high-affinity IL-2 receptors and has no signal-transducing activity per se. IL-2R alpha functions through enhancing binding of IL-2 to its receptor complex and acts as a positive feedback regulator. IL-2 is a principal growth factor for T lymphocytes and plays an important role in T cell immune response. IL-2R alpha transcription is regulated by three positive regulatory regions (PRRs): PRRI, PRRII and PRRIII. PRRIII is an IL-2 response element[1][2].
IL-2R alpha regulates T cell growth, augments lymphocyte activation and proliferation. IL-2R alpha is involved in preventing type 1 diabetes and cancers[1][2][4].

In Vivo

Mouse IL-2 (mIL-2)/CD25 (0.5 mg/kg; s.c.; twice a week for 1 week) induces a robust regulatory T cells (Tregs) expansion without showing signs of increase in the numbers of NK, CD4+ Foxp3, or CD8+ T cells or significant increase in proinflammatory cytokines[5].
Mouse IL-2 (mIL-2)/CD25 (0.2-0.4 mg/kg; s.c.; twice a week for 1 week) demonstrates efficacy in inducing Treg expansion, CD25 upregulation, and inhibiting lupus nephritis based on the levels of proteinuria, autoantibody titers, and kidney histology scores in both NZB ◊ NZW and MRL/lpr mice[5].

Biological Activity

Measured in a cell proliferation assay using MO7e cells. The ED50 for this effect is 0.5-1.5 μg/mL in the presence of 30 ng/mL of recombinant human IL-2.

  • Measured in a cell proliferation assay using MO7e cells. The ED50 for this effect is 0.8305 μg/mL in the presence of 30 ng/mL of recombinant human IL-2, corresponding to a specific activity is 1.2×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P01590/NP_032393.3 (E22-K236)

Gene ID
Protein Length

Extracellular Domain

Synonyms
Interleukin-2 receptor subunit alpha; IL-2-RA; CD25; TCGFR; p55
AA Sequence

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

Molecular Weight

40-60 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE..
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-2R alpha/CD25 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-2R alpha/CD25 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72550
Quantity:
MCE Japan Authorized Agent: