1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-25/IL-17E
  6. IL-25/IL-17E Protein, Canine (HEK293, Fc)

Interleukin 25, also known as IL-17E, is a unique cytokine of the IL-17 family. Interleukin 25 exclusively was shown to strongly induce expression of the cytokines associated with type 2 immunity. Interleukin 25 is a “barrier surface” cytokine whose expression depends on extrinsic environmental factors and when up-regulated may lead to inflammatory disorders such as atopic dermatitis, psoriasis or asthma. IL-25/IL-17E Protein, Canine (HEK293, Fc) is the recombinant canine-derived IL-25/IL-17E protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Interleukin 25, also known as IL-17E, is a unique cytokine of the IL-17 family. Interleukin 25 exclusively was shown to strongly induce expression of the cytokines associated with type 2 immunity. Interleukin 25 is a “barrier surface” cytokine whose expression depends on extrinsic environmental factors and when up-regulated may lead to inflammatory disorders such as atopic dermatitis, psoriasis or asthma. IL-25/IL-17E Protein, Canine (HEK293, Fc) is the recombinant canine-derived IL-25/IL-17E protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Interleukin 25, also known as IL-17E, is a unique cytokine of the IL-17 family. Interleukin 25 exclusively was shown to strongly induce expression of the cytokines associated with type 2 immunity. Interleukin 25 is a “barrier surface” cytokine whose expression depends on extrinsic environmental factors and when up-regulated may lead to inflammatory disorders such as atopic dermatitis, psoriasis or asthma. Interleukin 25 is expressed in activated Th2 T cells and induces a very different type of inflammatory response in vivo. Interleukin 25 enables cytokine activity. Interleukin 25 is located in extracellular region[1][2][3].

Biological Activity

Measured by its ability to induce CXCL1 secretion in HT‑29 human colon adenocarcinoma cells. The ED50 for this effect is 1.361 ng/mL, corresponding to a specific activity is 7.348×105 U/mg.

  • Measured by its ability to induce CXCL1 secretion in HT‑29 human colon adenocarcinoma cells. The ED50 for this effect is 1.361 ng/ml, corresponding to a specific activity is 7.348×105 U/mg.
Species

Canine

Source

HEK293

Tag

N-hFc

Accession

A0A8I3MRV2/XP_005623293 (L17-A169)

Gene ID
Molecular Construction
N-term
hFc
IL-17E (L17-A169)
Accession # A0A8I3MRV2/XP_005623293
C-term
Protein Length

Partial

Synonyms
Interleukin-25; IL-25; Interleukin-17E; IL-17E
AA Sequence

LNFRIRKDCTHWPNCCPSKRQDPTHEWLKRDTVLKFPGETTSLTHHPESCKASEDGPLNSRSISPWKYELDRDLNRLPQDLYHARCLCQHCVSLQTGSHMDPLGNSELLYHNQTVFYRRPCPGEQGAPDGYCLEQRLYRVSLACVCVRPRVMA

Molecular Weight

Approximately 50-55 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-25/IL-17E Protein, Canine (HEK293, Fc)
Cat. No.:
HY-P75858
Quantity:
MCE Japan Authorized Agent: