1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors B Cell CD Proteins NK Cell CD Proteins
  4. IL-21R IL-21R
  5. IL-21R Protein, Mouse (HEK293, Fc)

The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IL-21R Protein functions as a receptor specifically designed for interleukin-21, forming a heterodimeric complex with the common gamma subunit. This receptor complex, crucial for transducing signals initiated by interleukin-21, enables cellular responses to this cytokine. The IL-21R heterodimeric structure facilitates its interaction with Janus kinase 1 (JAK1), playing a pivotal role in initiating downstream signaling events in response to interleukin-21 binding. The association of IL-21R with the common gamma subunit and its interaction with JAK1 collectively contribute to the transduction of interleukin-21-mediated signals, thus influencing various cellular processes and immune responses.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-21, at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R protein. The ED50 for this effect is 25.10 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-21, at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21R protein. The ED50 for this effect is 25.10 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9JHX3 (C20-P236)

Gene ID
Molecular Construction
N-term
IL-21R (C20-P236)
Accession # Q9JHX3
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-21 receptor; IL-21 receptor; IL-21R; CD360; Nilr
AA Sequence

CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP

Molecular Weight

63-75 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4 (Normally trehalose is added as protectant before lyophilization. ) or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-21R Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-21R Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73889
Quantity:
MCE Japan Authorized Agent: