1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-20 Receptor
  5. IL-20R alpha
  6. IL-20R alpha Protein, Human (HEK293, His)

IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-20R alpha Protein (IL20RA) is the alpha subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL20RA/IL20RB dimer is a receptor for IL-19, IL-20 and IL-24, while the IL20RA/IL10RB dimer is a receptor for IL-26[3]. IL-20R alpha Protein is consists of 553 amino acids (M1-N553) with a transmembrane domain (251-271 a.a.). IL-20R alpha Protein, Human (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.

Background

IL-20R alpha, also known as a alpha subunit of IL-20 receptor (IL-20RA), belongs to the type II cytokine receptor family[1].
IL-20R alpha is widely expressed with highest levels in skin and testis and high levels in brain[2].
IL20RA and IL20RB is found to be upregulated in psoriatic skin lesions on keratinocytes[3].
IL-20R alpha forms functional heterodimers with different subunit protein. IL-20R alpha serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RB, however serves as the receptor for IL-26 by dimerizing with IL-10RB. IL-20R alpha transduces ligand-binding at least in part through STAT3 activation, and plays an important role in epidermal function and psoriasis[4].
The sequence of amino acids in IL-12 beta proteins of human is very different from mouse (64.64%).

In Vitro

IL-20 receptor mRNA is decreased in psoriasis, and shows high protein level in mononuclear leukocytes in the papillary dermis and along the dermoepidermal junction[4].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UHF4-1 (V30-K250)

Gene ID
Molecular Construction
N-term
IL-20Rα (V30-K250)
Accession # Q9UHF4-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-20 receptor subunit alpha; IL-20R-alpha; IL-20RA; CRF2-8; IL-20R1; ZcytoR7
AA Sequence

VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

Predicted Molecular Mass
26.3 kDa
Molecular Weight

Approximately 35-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-20R alpha Protein, Human (HEK293, His)
Cat. No.:
HY-P72562
Quantity:
MCE Japan Authorized Agent: