1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-20
  5. IL-20 Protein, Mouse (HEK293, His)

IL-20 protein is secreted by monocytes and skin keratinocytes and is a proinflammatory cytokine critical for immune responses, inflammatory regulation, hematopoiesis, and epidermal cell differentiation. It enhances tissue remodeling and wound healing, maintaining epithelial integrity during infection. IL-20 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-20 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-20 protein is secreted by monocytes and skin keratinocytes and is a proinflammatory cytokine critical for immune responses, inflammatory regulation, hematopoiesis, and epidermal cell differentiation. It enhances tissue remodeling and wound healing, maintaining epithelial integrity during infection. IL-20 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-20 protein, expressed by HEK293 , with N-His labeled tag.

Background

IL-20 Protein, a pro-inflammatory and angiogenic cytokine, is primarily secreted by monocytes and skin keratinocytes, and it serves crucial roles in immune responses, regulation of inflammatory responses, hemopoiesis, as well as epidermal cell and keratinocyte differentiation. This protein enhances tissue remodeling and wound-healing activities, playing a key role in maintaining the integrity of epithelial layers during infection and inflammatory responses. IL-20 Protein affects various actin-mediated functions in activated neutrophils, leading to the inhibition of phagocytosis, granule exocytosis, and migration. Its effects are exerted through the type I IL-20 receptor complex (IL20RA and IL20RB) or the type II IL-20 receptor complex (IL22RA1 and IL20RB). Furthermore, IL-20 Protein activates a range of signaling processes, including phosphorylations of JAK2 and STAT5, as well as the activation of serine and threonine kinases AKT and ERK1/2. In keratinocytes, it can activate STAT3 phosphorylation and transcriptional activity in a JAK2, ERK1/2, and p38 MAPK-dependent manner. IL-20 Protein forms a 1:1:1 heterotrimeric complex with its primary high-affinity heterodimeric receptor IL20RA/IL20RB.

Biological Activity

Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is 1.358 ng/mL. Corresponding to a specific activity is 7.364×105 units/mg.

  • Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is 1.358 ng/mL. corresponding to a specific activity is 7.364×105 units/mg.
Species

Mouse

Source

HEK293

Tag

N-His

Accession

Q9JKV9 (L25-L176)

Gene ID
Molecular Construction
N-term
IL-2 (L25-L176)
Accession # Q9JKV9
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL-20; Cytokine Zcyto10; Zcyto10; IL10D; MGC96907
AA Sequence

LKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML

Molecular Weight

Approximately 18-22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-20 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-20 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77964
Quantity:
MCE Japan Authorized Agent: